Web Analysis for Petrocargosac - petrocargosac.com
3.33
Rating by CuteStat
petrocargosac.com is 5 years 5 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, petrocargosac.com is SAFE to browse.
PageSpeed Score
100
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 192.185.108.139)
Trick Photography Ideas
- trickphotographyideas.net
how to do trick photography and special effects review
Not Applicable
$
8.95
Trick Photography And Special Effects 2nd Edition Pdf
- trickphotographyandspecialeffectsreview.net
how to do trick photography and special effects
Not Applicable
$
8.95
Trick Photography
- trickphotographyspecialeffects.org
trick photography techniques how to shoot trick photos
Not Applicable
$
8.95
Trick Photography And Special Effects 2nd Edition Pdf
- trickphotographyandspecialeffectspdf.net
how to do trick photography and special effects
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Server: nginx/1.14.1
Date: Sun, 06 Jan 2019 13:16:26 GMT
Content-Type: text/html;charset=ISO-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip
Server: nginx/1.14.1
Date: Sun, 06 Jan 2019 13:16:26 GMT
Content-Type: text/html;charset=ISO-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1509.websitewelcome.com | 192.185.108.133 | United States of America | |
ns1510.websitewelcome.com | 192.185.108.134 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
petrocargosac.com | A | 10798 |
IP: 192.185.108.139 |
petrocargosac.com | NS | 86400 |
Target: ns1510.websitewelcome.com |
petrocargosac.com | NS | 86400 |
Target: ns1509.websitewelcome.com |
petrocargosac.com | SOA | 10798 |
MNAME: ns1509.websitewelcome.com RNAME: ahdedios.hotmail.com Serial: 2019010402 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
petrocargosac.com | MX | 14400 |
Target: mail.petrocargosac.com |
petrocargosac.com | TXT | 14400 |
TXT: v=spf1 a mx include:websitewelcome.com ~all |
Full WHOIS Lookup
Domain Name: PETROCARGOSAC.COM
Registry Domain ID: 2349787977_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2019-01-04T22:46:30Z
Creation Date: 2019-01-04T22:21:25Z
Registry Expiry Date: 2020-01-04T22:21:25Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1509.WEBSITEWELCOME.COM
Name Server: NS1510.WEBSITEWELCOME.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-01-06T13:16:19Z
Registry Domain ID: 2349787977_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2019-01-04T22:46:30Z
Creation Date: 2019-01-04T22:21:25Z
Registry Expiry Date: 2020-01-04T22:21:25Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1509.WEBSITEWELCOME.COM
Name Server: NS1510.WEBSITEWELCOME.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-01-06T13:16:19Z